PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa09g088880.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family B3
Protein Properties Length: 417aa    MW: 47121.2 Da    PI: 8.318
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa09g088880.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B359.27.3e-1970159495
                     E-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEE CS
              B3   4 vltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvk 95 
                     + +++ +l+++ l+lp +f++++++k ++  +++l+d + rsW + l+++k s+++++++GWk+F+++ng  +g f++Fkl+++ +++++++
  Csa09g088880.1  70 AHVTAASLETDALYLPQDFTSSNDLKRKC-CKIVLKDGEERSWAMDLRFNKLSDTCYISRGWKHFCDENGKYAGSFFTFKLMEN-GETPLLS 159
                     556788899999***********999655.6**************************************************985.4445555 PP

2B359.65.6e-19192284197
                     EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEE CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvk 95 
                     f++ ++++d+lks+rl+lp +f++e+g++  +++++tl  ++g +W  +l  r +sgr+ l+kG k+F +angLk g++++++l++ +++++v+ 
  Csa09g088880.1 192 FVTLTLTNDSLKSSRLYLPLPFVRENGMN--NPRMVTLLGKDGIRWAANL-LRENSGRMSLGKGMKDFSRANGLKIGESFTLELIW-ENATPVLN 282
                     7788899*******************999..5669***************.799999*****************************.77778887 PP

                     EE CS
              B3  96 vf 97 
                     +f
  Csa09g088880.1 283 LF 284
                     76 PP

3B355.88.4e-18294391198
                     EEEE-..-HHHHTT-E....E--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE. CS
              B3   1 ffkvltpsdvlksgrl....vlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefe 91 
                     f++ ++++d+l+++rl     lp +f++e++++k++  ++ l  ++g +W  +l  + ++gr+ l+kGWkeF+kangL++g +++++ ++ ++++
  Csa09g088880.1 294 FVTLTVTHDSLNNNRLnlfqGLPLSFMRENDMNKPG--KIALLGKDGTKWIANL-LQESRGRMSLGKGWKEFAKANGLEVGVSFTLESIW-EDTT 384
                     7788999******999888899********999766..7***************.7999999*************************999.8888 PP

                     .EEEEE- CS
              B3  92 lvvkvfr 98 
                     +++++f+
  Csa09g088880.1 385 PMLGLFS 391
                     9999986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.101.4E-1762158IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.35E-1963167IPR015300DNA-binding pseudobarrel domain
CDDcd100171.43E-1467160No hitNo description
SMARTSM010192.2E-1867164IPR003340B3 DNA binding domain
PROSITE profilePS5086313.46567164IPR003340B3 DNA binding domain
PfamPF023622.8E-1770157IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.4E-18183281IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.96E-19189286IPR015300DNA-binding pseudobarrel domain
CDDcd100178.24E-18191285No hitNo description
SMARTSM010192.0E-27192287IPR003340B3 DNA binding domain
PfamPF023621.3E-18192284IPR003340B3 DNA binding domain
PROSITE profilePS5086313.874192287IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.108.7E-16288386IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.37E-16291387IPR015300DNA-binding pseudobarrel domain
CDDcd100171.15E-14293391No hitNo description
SMARTSM010191.4E-21294393IPR003340B3 DNA binding domain
PROSITE profilePS5086312.069294393IPR003340B3 DNA binding domain
PfamPF023622.5E-17294391IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 417 aa     Download sequence    Send to blast
KKKEKTPIVL RYSGAFYEQR LGHHRSNPEG VDMMIEDASD HHDNNIEYQR KKKVKQNNPE  60
TEPDCSCFVA HVTAASLETD ALYLPQDFTS SNDLKRKCCK IVLKDGEERS WAMDLRFNKL  120
SDTCYISRGW KHFCDENGKY AGSFFTFKLM ENGETPLLSV WPTKSENDRT HGDNNSSHSD  180
SDSTSPPNRN RFVTLTLTND SLKSSRLYLP LPFVRENGMN NPRMVTLLGK DGIRWAANLL  240
RENSGRMSLG KGMKDFSRAN GLKIGESFTL ELIWENATPV LNLFCKEVKI QNRFVTLTVT  300
HDSLNNNRLN LFQGLPLSFM RENDMNKPGK IALLGKDGTK WIANLLQESR GRMSLGKGWK  360
EFAKANGLEV GVSFTLESIW EDTTPMLGLF SIESTSDKRQ QGECCSNASE NKSIST*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010429453.10.0PREDICTED: B3 domain-containing protein REM12-like isoform X1
SwissprotP0CAP41e-104REM12_ARATH; B3 domain-containing protein REM12
TrEMBLM4C8L71e-165M4C8L7_BRARP; Uncharacterized protein
STRINGBra000545.1-P1e-164(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM78281641
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24680.11e-99B3 family protein